(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE77

ACAM1_4.PE77         Location/Qualifiers
FT   CDS             complement(75338..75811)
FT                   /locus_tag="AM1_C0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="1A family penicillin-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340532"
FT                   /db_xref="GeneID:5686299"
FT                   /translation="MQLTTSVYVIVTQLRGSLQASAYATFANNGWQSKTTAILQVTDRS
FT                   GKALIDNPPQPKLVLNQWAVASVNSTLQTVVQSGTGIAAQIGRPAAGKTGTTSSERDVW
FT                   FVGYVPQLSVAVWEGNDNYARIGAGATGGGWMAPVWREFMSEALKDLSTGQKA"
FT                   /protein_id="YP_001521526.1"
     MQLTTSVYVI VTQLRGSLQA SAYATFANNG WQSKTTAILQ VTDRSGKALI DNPPQPKLVL        60
     NQWAVASVNS TLQTVVQSGT GIAAQIGRPA AGKTGTTSSE RDVWFVGYVP QLSVAVWEGN       120
     DNYARIGAGA TGGGWMAPVW REFMSEALKD LSTGQKA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page