(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE78

ACAM1_4.PE78         Location/Qualifiers
FT   CDS             75949..77679
FT                   /locus_tag="AM1_C0078"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, putative"
FT                   /transl_table="11"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="GI:158340533"
FT                   /db_xref="GeneID:5686300"
FT                   /translation="MPAPIKPQQVHLYMQTKQSGSSQETAAAKAGISTRTAHRIDSGTH
FT                   RPQRGRPHDWKTREDPLDGLWELELEPMLEREPRLEATTLFETLQENHPGQYDDKIRTV
FT                   QRRTAKWKAAHGKPKEVMFKIQHHPGEMGQSDFAQLKGFSVTVQGEAFHHILYHYRLSY
FT                   SGWQYVQVIQGGESFIGLSQGLQNALTACGGVPKIHRTDSLSAAYRNTGGRNPQLTQLY
FT                   STLCDHYRMQPTRNNLGVSHENGGIEGSHGYFKRRLCQALYRRGSFDFDSVAEYQQFIE
FT                   QVIAKLNAKCQKKFALELPTLQPLPRYRTPDYEVRSAKVSCNSTIAVRCVLYTVPSRLI
FT                   GHRLKLHLYHDRLVGFLGTTPVVELARVHVHGSEKKRRARSIDYKHVAESLRRKPNAFL
FT                   YCQWQSELLPNLQWHQLWESLKANFEQDQAARLITEALYIAATQDQESQVADYLQTQLE
FT                   QSTLTLSRLKQAFEFKLSTEQYPDVTSQQHDLSDYDQLLHSRPGQPIPVADDNPKTVAV
FT                   EAFPRRVAEHRASSDSGELVLRPVSVGFSSRRSQPSGAESDFTRSNRSAAALRKVLDQF
FT                   "
FT                   /protein_id="YP_001521527.1"
     MPAPIKPQQV HLYMQTKQSG SSQETAAAKA GISTRTAHRI DSGTHRPQRG RPHDWKTRED        60
     PLDGLWELEL EPMLEREPRL EATTLFETLQ ENHPGQYDDK IRTVQRRTAK WKAAHGKPKE       120
     VMFKIQHHPG EMGQSDFAQL KGFSVTVQGE AFHHILYHYR LSYSGWQYVQ VIQGGESFIG       180
     LSQGLQNALT ACGGVPKIHR TDSLSAAYRN TGGRNPQLTQ LYSTLCDHYR MQPTRNNLGV       240
     SHENGGIEGS HGYFKRRLCQ ALYRRGSFDF DSVAEYQQFI EQVIAKLNAK CQKKFALELP       300
     TLQPLPRYRT PDYEVRSAKV SCNSTIAVRC VLYTVPSRLI GHRLKLHLYH DRLVGFLGTT       360
     PVVELARVHV HGSEKKRRAR SIDYKHVAES LRRKPNAFLY CQWQSELLPN LQWHQLWESL       420
     KANFEQDQAA RLITEALYIA ATQDQESQVA DYLQTQLEQS TLTLSRLKQA FEFKLSTEQY       480
     PDVTSQQHDL SDYDQLLHSR PGQPIPVADD NPKTVAVEAF PRRVAEHRAS SDSGELVLRP       540
     VSVGFSSRRS QPSGAESDFT RSNRSAAALR KVLDQF                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page