(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE79

ACAM1_4.PE79         Location/Qualifiers
FT   CDS             77468..78223
FT                   /locus_tag="AM1_C0079"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /transl_table="11"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="GI:158340534"
FT                   /db_xref="GeneID:5686301"
FT                   /translation="MLMTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEAS
FT                   RREQNRISRALTEAQLPYGKSWTNFEFAHVPTLNPAALMEFAQTTHWLESGSNILIFGP
FT                   SGTGKTHVSSALGASIIELGKRVKFVTATTLVQQLQLAKLQLELQSLLSKLDRYDLLII
FT                   DDLGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDSIFPNSMMTVAAIDRLIH
FT                   HATIFEMQAESFRKQEAAKHTAKSQKTDS"
FT                   /protein_id="YP_001521528.1"
     MLMTTLKQLR LRHFLDEWQS IEHQATQENW SYAQFLLALA QGEASRREQN RISRALTEAQ        60
     LPYGKSWTNF EFAHVPTLNP AALMEFAQTT HWLESGSNIL IFGPSGTGKT HVSSALGASI       120
     IELGKRVKFV TATTLVQQLQ LAKLQLELQS LLSKLDRYDL LIIDDLGYVQ KSDVETSVLF       180
     ELIAHRYERK SLLITANQPF SQWDSIFPNS MMTVAAIDRL IHHATIFEMQ AESFRKQEAA       240
     KHTAKSQKTD S                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page