(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE80

ACAM1_4.PE80         Location/Qualifiers
FT   CDS             complement(78542..79390)
FT                   /locus_tag="AM1_C0080"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase, catalytic region"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340535"
FT                   /db_xref="GeneID:5686302"
FT                   /translation="MVNQLKEHYPIQMICNVIGYSRSRYYYHQNPGKENRKEVILKSAI
FT                   ADVAGRYPTHGYRRITQQLRREGHTVNHKRVSRLMRGMGLLAKQRVQRKRTTNSVHGYK
FT                   RYPNLVKALTMVRPNQVWVADITYIRLREEFVYLAVLMDVFTRGIRGWHLDWTMEKSLT
FT                   ITALEKALLGHTPEIHHSDQGVQYAANDYVKMLEDNDVKISMAAVGKAYENGFAERLMR
FT                   TIKEEEVDLSEYRNFREVNERIEMFLEEVYMKKRIHSSLSYLTPSEFEEKWRYEQENIQ
FT                   M"
FT                   /protein_id="YP_001521529.1"
     MVNQLKEHYP IQMICNVIGY SRSRYYYHQN PGKENRKEVI LKSAIADVAG RYPTHGYRRI        60
     TQQLRREGHT VNHKRVSRLM RGMGLLAKQR VQRKRTTNSV HGYKRYPNLV KALTMVRPNQ       120
     VWVADITYIR LREEFVYLAV LMDVFTRGIR GWHLDWTMEK SLTITALEKA LLGHTPEIHH       180
     SDQGVQYAAN DYVKMLEDND VKISMAAVGK AYENGFAERL MRTIKEEEVD LSEYRNFREV       240
     NERIEMFLEE VYMKKRIHSS LSYLTPSEFE EKWRYEQENI QM                          282
//

If you have problems or comments...

PBIL Back to PBIL home page