(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_4.PE9

ACAM1_4.PE9          Location/Qualifiers
FT   CDS             complement(4020..4808)
FT                   /locus_tag="AM1_C0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158340464"
FT                   /db_xref="GeneID:5686231"
FT                   /translation="MQNQLEGSKWMANFQEIHAHMEFEEWAYQQGLQDSEKYLIETYLD
FT                   KSGKTVEAGTGGGRILLAMQNLGFKHLYGFDYLTDFIDAATKNDQTQQIIFTAQNASQL
FT                   NYQDCFFDNAIYLQQVVCYPDSDTERLKVLQEAYRILKVGGIAIFSVLLFDARLKSLAY
FT                   SLFIQYIRLLRVLRFSQRSIQYLPSLQIQRQNNYSALLDAPPYMYWYKMEEFYRALTEL
FT                   NFEVIAMGTNHQVDCRKTSDTPTELAQLSLGNQLYCVCRK"
FT                   /protein_id="YP_001521458.1"
     MQNQLEGSKW MANFQEIHAH MEFEEWAYQQ GLQDSEKYLI ETYLDKSGKT VEAGTGGGRI        60
     LLAMQNLGFK HLYGFDYLTD FIDAATKNDQ TQQIIFTAQN ASQLNYQDCF FDNAIYLQQV       120
     VCYPDSDTER LKVLQEAYRI LKVGGIAIFS VLLFDARLKS LAYSLFIQYI RLLRVLRFSQ       180
     RSIQYLPSLQ IQRQNNYSAL LDAPPYMYWY KMEEFYRALT ELNFEVIAMG TNHQVDCRKT       240
     SDTPTELAQL SLGNQLYCVC RK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page