(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE1

ACAM1_7.PE1          Location/Qualifiers
FT   CDS             3..311
FT                   /locus_tag="AM1_F0001"
FT                   /gene_family="HOG000288608" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341328"
FT                   /db_xref="GeneID:5686922"
FT                   /translation="MNVVENWNSANDFIFYGKNGDFASNQTAMQELSMLCLHLLQISLV
FT                   YINTLMIQKVLSEPTWMNRMQEEDLRALTPLFYLHINPYGRFRLNMNERLVIENLAA"
FT                   /protein_id="YP_001522307.1"
     MNVVENWNSA NDFIFYGKNG DFASNQTAMQ ELSMLCLHLL QISLVYINTL MIQKVLSEPT        60
     WMNRMQEEDL RALTPLFYLH INPYGRFRLN MNERLVIENL AA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page