(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE11

ACAM1_7.PE11         Location/Qualifiers
FT   CDS             11880..12224
FT                   /locus_tag="AM1_F0011"
FT                   /gene_family="HOG000269309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341319"
FT                   /db_xref="GeneID:5686932"
FT                   /translation="MTITEATQATTIAQLNDRFRQGDHTLGQVYTTQLVQGLSSEEQQE
FT                   LFRLVRTFDDFNLSNDPRGEHNFGRIKFKGEVFNFKIDYYSPDLIHGSEDPEDLTITIR
FT                   VLTLMHSSEY"
FT                   /protein_id="YP_001522317.1"
     MTITEATQAT TIAQLNDRFR QGDHTLGQVY TTQLVQGLSS EEQQELFRLV RTFDDFNLSN        60
     DPRGEHNFGR IKFKGEVFNF KIDYYSPDLI HGSEDPEDLT ITIRVLTLMH SSEY             114
//

If you have problems or comments...

PBIL Back to PBIL home page