(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE12

ACAM1_7.PE12         Location/Qualifiers
FT   CDS             complement(12473..13576)
FT                   /locus_tag="AM1_F0012"
FT                   /gene_family="HOG000023286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="SCP-like Type I secretion target protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341318"
FT                   /db_xref="GeneID:5686933"
FT                   /translation="MTILEQDRFDQQLLDLVNQERESRGLRPLQLSQNLDQAADQHSAR
FT                   MATGDFFAHRDPQTGTSAGDRIEAAGYTGWSTWGENIAAGQATPEAVLNAWMGSSGHRA
FT                   NILNPNFTHMGIGYDLLENDTGNQRYSHYWTQVFGAGGVTGTYVAQTDGNTTAGNPSNP
FT                   NTPPAPVNPPLTPPVEAPLVGTPGNDQLIGTDSNDNIFGRGGNDILRGQFGNDMLYGEA
FT                   GQDRLYGDAGADQLYGGLDNDTLWGGAGNDSLIGVDTNSPNSASQVDVLVGGQNADMFV
FT                   LGDASAVFYNDGIDNTYGTANYAYIYDFQSVQGDQIQLSGSSGDYRLQSYSSGHLLFLN
FT                   TPGADEVIAFIANTKSLSLTNSVFMFV"
FT                   /protein_id="YP_001522318.1"
     MTILEQDRFD QQLLDLVNQE RESRGLRPLQ LSQNLDQAAD QHSARMATGD FFAHRDPQTG        60
     TSAGDRIEAA GYTGWSTWGE NIAAGQATPE AVLNAWMGSS GHRANILNPN FTHMGIGYDL       120
     LENDTGNQRY SHYWTQVFGA GGVTGTYVAQ TDGNTTAGNP SNPNTPPAPV NPPLTPPVEA       180
     PLVGTPGNDQ LIGTDSNDNI FGRGGNDILR GQFGNDMLYG EAGQDRLYGD AGADQLYGGL       240
     DNDTLWGGAG NDSLIGVDTN SPNSASQVDV LVGGQNADMF VLGDASAVFY NDGIDNTYGT       300
     ANYAYIYDFQ SVQGDQIQLS GSSGDYRLQS YSSGHLLFLN TPGADEVIAF IANTKSLSLT       360
     NSVFMFV                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page