(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE14

ACAM1_7.PE14         Location/Qualifiers
FT   CDS             14310..14465
FT                   /locus_tag="AM1_F0014"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341316"
FT                   /db_xref="GeneID:5686935"
FT                   /translation="MKMYIANILVWNGREFMMLPFQQAQTQENLGVVIREYVAAMGLRL
FT                   VYWSKV"
FT                   /protein_id="YP_001522320.1"
     MKMYIANILV WNGREFMMLP FQQAQTQENL GVVIREYVAA MGLRLVYWSK V                 51
//

If you have problems or comments...

PBIL Back to PBIL home page