(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE15

ACAM1_7.PE15         Location/Qualifiers
FT   CDS             14508..14849
FT                   /locus_tag="AM1_F0015"
FT                   /gene_family="HOG000022978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341315"
FT                   /db_xref="GeneID:5686936"
FT                   /translation="MDVLILEILSIHLKVGDVLELALIDKKFATEQMIEIPIACKLVKK
FT                   DAIVVHFHHHELDLDFNTVDIHSKNDHRYLTIHSLEIVDPEKGYLVINEEDGAVRYQVA
FT                   WKKISTTYE"
FT                   /protein_id="YP_001522321.1"
     MDVLILEILS IHLKVGDVLE LALIDKKFAT EQMIEIPIAC KLVKKDAIVV HFHHHELDLD        60
     FNTVDIHSKN DHRYLTIHSL EIVDPEKGYL VINEEDGAVR YQVAWKKIST TYE              113
//

If you have problems or comments...

PBIL Back to PBIL home page