(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE16

ACAM1_7.PE16         Location/Qualifiers
FT   CDS             14917..15132
FT                   /locus_tag="AM1_F0016"
FT                   /gene_family="HOG000022979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341314"
FT                   /db_xref="GeneID:5686937"
FT                   /translation="MQPPGIPHQGAFFMMPRGNPIKMYVAKIEVWNGRSFQLIDFQQAQ
FT                   TQESLRLVIRECVAAMGLKLIYWYES"
FT                   /protein_id="YP_001522322.1"
     MQPPGIPHQG AFFMMPRGNP IKMYVAKIEV WNGRSFQLID FQQAQTQESL RLVIRECVAA        60
     MGLKLIYWYE S                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page