(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE18

ACAM1_7.PE18         Location/Qualifiers
FT   CDS             15848..16381
FT                   /locus_tag="AM1_F0018"
FT                   /gene_family="HOG000023062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341312"
FT                   /db_xref="GeneID:5686939"
FT                   /translation="MTVSVPPPTLTSNSQIPSHQTYVRPLGFGESPSGLAIFCNRANTN
FT                   TWYTLSQDSQPVELPYPALTGYLTSIEFIKGEYKRKPTCKLRFRMIAHRPCTLEAGSES
FT                   TFTKGFLSAIASLSPEQLRSPITIEAIPADEETVLFCSVWSGGQKVRTQWDDQTNWREV
FT                   ARRAKDNVAQLQSS"
FT                   /protein_id="YP_001522324.1"
     MTVSVPPPTL TSNSQIPSHQ TYVRPLGFGE SPSGLAIFCN RANTNTWYTL SQDSQPVELP        60
     YPALTGYLTS IEFIKGEYKR KPTCKLRFRM IAHRPCTLEA GSESTFTKGF LSAIASLSPE       120
     QLRSPITIEA IPADEETVLF CSVWSGGQKV RTQWDDQTNW REVARRAKDN VAQLQSS          177
//

If you have problems or comments...

PBIL Back to PBIL home page