(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE19

ACAM1_7.PE19         Location/Qualifiers
FT   CDS             16356..16589
FT                   /locus_tag="AM1_F0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341311"
FT                   /db_xref="GeneID:5686940"
FT                   /translation="MWLNFRVADESNLDWQALKTLTEYCREDIKGFFEDEGFQIYPGRL
FT                   HPYQALFLSNFFVQLVGTRGVLCLLLAGPVSL"
FT                   /protein_id="YP_001522325.1"
     MWLNFRVADE SNLDWQALKT LTEYCREDIK GFFEDEGFQI YPGRLHPYQA LFLSNFFVQL        60
     VGTRGVLCLL LAGPVSL                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page