(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE20

ACAM1_7.PE20         Location/Qualifiers
FT   CDS             17129..17338
FT                   /locus_tag="AM1_F0020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341310"
FT                   /db_xref="GeneID:5686941"
FT                   /translation="MAITVINLRYNRNVKGYRCDRASVLGNPFHMFQESERLAVVAAFR
FT                   EYLHEVANLGANPVDVVLLLAEKY"
FT                   /protein_id="YP_001522326.1"
     MAITVINLRY NRNVKGYRCD RASVLGNPFH MFQESERLAV VAAFREYLHE VANLGANPVD        60
     VVLLLAEKY                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page