(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE22

ACAM1_7.PE22         Location/Qualifiers
FT   CDS             17890..18051
FT                   /locus_tag="AM1_F0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341308"
FT                   /db_xref="GeneID:5686943"
FT                   /translation="MIHKSSGRPCCRWLCKDCGKSRGIYPTPKFLMNLREMDEGGETEV
FT                   GLKVLAQV"
FT                   /protein_id="YP_001522328.1"
     MIHKSSGRPC CRWLCKDCGK SRGIYPTPKF LMNLREMDEG GETEVGLKVL AQV               53
//

If you have problems or comments...

PBIL Back to PBIL home page