(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE23

ACAM1_7.PE23         Location/Qualifiers
FT   CDS             18048..18533
FT                   /locus_tag="AM1_F0023"
FT                   /gene_family="HOG000023169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341307"
FT                   /db_xref="GeneID:5686944"
FT                   /translation="MIGEKVMAIYSASYFEPHNHHGALVSISRSHPRSFQVDDRLPFLA
FT                   PSRQLLDDWKHRQLTEAGYTDRYRQELQQSWSQVNSWLASVTPEGDCTLLCWEKAGEFC
FT                   HRNLAMKVIRKHRPDCYGGRDISADPGLRCSKCQTVIIPGLDQSFCPCCGEWLATPI"
FT                   /protein_id="YP_001522329.1"
     MIGEKVMAIY SASYFEPHNH HGALVSISRS HPRSFQVDDR LPFLAPSRQL LDDWKHRQLT        60
     EAGYTDRYRQ ELQQSWSQVN SWLASVTPEG DCTLLCWEKA GEFCHRNLAM KVIRKHRPDC       120
     YGGRDISADP GLRCSKCQTV IIPGLDQSFC PCCGEWLATP I                           161
//

If you have problems or comments...

PBIL Back to PBIL home page