(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE28

ACAM1_7.PE28         Location/Qualifiers
FT   CDS             20327..21097
FT                   /locus_tag="AM1_F0028"
FT                   /gene_family="HOG000151992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage protein Gp37/Gp68, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341302"
FT                   /db_xref="GeneID:5686949"
FT                   /translation="MENSEIEWTNHTFNPWIGFSHYSPGYVNCYAETQMDKRYDRVKWG
FT                   VVGTRTRTSESYWKLPYKWNRKAAERGGTETVFCGSLADVFEDRDDLIDWRLDLFDTVI
FT                   DKTPNLTWLLLTKRIDMAVLFLTWVRVPPNVWLGHSICTQRESDVVIPKLAKLQHKVGG
FT                   IFLSCEPLLEPLDLGALPVNWVIIGGGSGPSARPCDVAWVRSIRDQCKSVDVPVLIKQL
FT                   GSNPVGVPKLRSAKGGDILEWPKDLRVWEFPEFG"
FT                   /protein_id="YP_001522334.1"
     MENSEIEWTN HTFNPWIGFS HYSPGYVNCY AETQMDKRYD RVKWGVVGTR TRTSESYWKL        60
     PYKWNRKAAE RGGTETVFCG SLADVFEDRD DLIDWRLDLF DTVIDKTPNL TWLLLTKRID       120
     MAVLFLTWVR VPPNVWLGHS ICTQRESDVV IPKLAKLQHK VGGIFLSCEP LLEPLDLGAL       180
     PVNWVIIGGG SGPSARPCDV AWVRSIRDQC KSVDVPVLIK QLGSNPVGVP KLRSAKGGDI       240
     LEWPKDLRVW EFPEFG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page