(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE30

ACAM1_7.PE30         Location/Qualifiers
FT   CDS             21209..21517
FT                   /locus_tag="AM1_F0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341300"
FT                   /db_xref="GeneID:5686951"
FT                   /translation="MIRKFKTSNFYQENYIGYMEDGSFDEVLICTYICPGGTSLYQEDV
FT                   WQQNSDINFEIFYLSEPAHAYLYIGCAHWFIPVAFAERLFSVFQTGKANACPGWTAD"
FT                   /protein_id="YP_001522336.1"
     MIRKFKTSNF YQENYIGYME DGSFDEVLIC TYICPGGTSL YQEDVWQQNS DINFEIFYLS        60
     EPAHAYLYIG CAHWFIPVAF AERLFSVFQT GKANACPGWT AD                          102
//

If you have problems or comments...

PBIL Back to PBIL home page