(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE32

ACAM1_7.PE32         Location/Qualifiers
FT   CDS             22291..22761
FT                   /locus_tag="AM1_F0033"
FT                   /gene_family="HOG000023058" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341297"
FT                   /db_xref="GeneID:5686953"
FT                   /translation="MPTYDFEQQFEIGTHHEQTLDEYFQQYFWIESTSRQEQRQGIDRW
FT                   FQAPDGSWMSVEYKADKTAGRTGNAFIETISVDVRAVQGWAYSSEADVLAYYVPPRHTV
FT                   WLICFVELRQYLAEWHQRYPIRQIPNHGYCTEGLLVPLVLLSNIAFEVCHVT"
FT                   /protein_id="YP_001522338.1"
     MPTYDFEQQF EIGTHHEQTL DEYFQQYFWI ESTSRQEQRQ GIDRWFQAPD GSWMSVEYKA        60
     DKTAGRTGNA FIETISVDVR AVQGWAYSSE ADVLAYYVPP RHTVWLICFV ELRQYLAEWH       120
     QRYPIRQIPN HGYCTEGLLV PLVLLSNIAF EVCHVT                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page