(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE35

ACAM1_7.PE35         Location/Qualifiers
FT   CDS             23986..24666
FT                   /locus_tag="AM1_F0035"
FT                   /gene_family="HOG000023057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341295"
FT                   /db_xref="GeneID:5686956"
FT                   /translation="MKLITSIKLQQADHTEVIDSAATQVGLAANKAFLFVVRKEIQGWK
FT                   NFTALCSWCLSKVSQKHGPIFEEVKERAVAVYRKGCQQETAFVQALIKSQITDRLDAHW
FT                   KLHDQAIDWFKDQTQAFLADSPVEDTSEVEVEDLSPDSSEDLEEIAPVDEGEEPSMTIL
FT                   DEAPVPVLGPPVDPDPLDDELTVPQDPTPVVASGGGKRRTRNKSKRTPLGAMMLSQAKT
FT                   GKPS"
FT                   /protein_id="YP_001522341.1"
     MKLITSIKLQ QADHTEVIDS AATQVGLAAN KAFLFVVRKE IQGWKNFTAL CSWCLSKVSQ        60
     KHGPIFEEVK ERAVAVYRKG CQQETAFVQA LIKSQITDRL DAHWKLHDQA IDWFKDQTQA       120
     FLADSPVEDT SEVEVEDLSP DSSEDLEEIA PVDEGEEPSM TILDEAPVPV LGPPVDPDPL       180
     DDELTVPQDP TPVVASGGGK RRTRNKSKRT PLGAMMLSQA KTGKPS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page