(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE36

ACAM1_7.PE36         Location/Qualifiers
FT   CDS             24841..25569
FT                   /locus_tag="AM1_F0036"
FT                   /gene_family="HOG000023288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CobQ/CobB/MinD/ParA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656)"
FT                   /db_xref="GI:158341294"
FT                   /db_xref="GeneID:5686957"
FT                   /translation="MTVSRIAVAGRKGGVGKTTIACGIASILASMQQRVLVIDMDPQSN
FT                   AAYVLGVDPTKPGTASLLVGDHLEPLKVGDYLWVLPGGPELMNHNIQSCDQEELADAVF
FT                   GMDYDVVVFDCPPGNEHLERLAIKAADTVLIVSDAHPLALVGASRVIKELKLNSQKGRK
FT                   GASRWAIIQSKIDARRAMDRTFDSDLAESFPNLQRFVVRQDTQLSLAAADQIPLMTYDA
FT                   KCRGAQDLIVVAQWGLNGSA"
FT                   /protein_id="YP_001522342.1"
     MTVSRIAVAG RKGGVGKTTI ACGIASILAS MQQRVLVIDM DPQSNAAYVL GVDPTKPGTA        60
     SLLVGDHLEP LKVGDYLWVL PGGPELMNHN IQSCDQEELA DAVFGMDYDV VVFDCPPGNE       120
     HLERLAIKAA DTVLIVSDAH PLALVGASRV IKELKLNSQK GRKGASRWAI IQSKIDARRA       180
     MDRTFDSDLA ESFPNLQRFV VRQDTQLSLA AADQIPLMTY DAKCRGAQDL IVVAQWGLNG       240
     SA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page