(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE37

ACAM1_7.PE37         Location/Qualifiers
FT   CDS             25556..26356
FT                   /locus_tag="AM1_F0037"
FT                   /gene_family="HOG000023289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341293"
FT                   /db_xref="GeneID:5686958"
FT                   /translation="MAQRKTNTKRFQQALNVADDMSVIDQAISNDTNSNRYLKTAILLD
FT                   QIKLRSEDTRELNQDHVFALSESIEVLGLIEPLVVDTRNRLLAGGHRLSAIHFLRDNKQ
FT                   ERYDEQFPGSKIPVRVMPFDADQDPEKALQCEVAENEHRRDYTATEVRNLAERLKKAGY
FT                   SHGKGRPRKGKKALLPALEVIIGKHTRTIQRYLSDHQKENTTNVALTAETKKLKRIEKD
FT                   LLAWKNENMHCTANSKKALLLKRIPSMAKLINQVLTEIQTQDGN"
FT                   /protein_id="YP_001522343.1"
     MAQRKTNTKR FQQALNVADD MSVIDQAISN DTNSNRYLKT AILLDQIKLR SEDTRELNQD        60
     HVFALSESIE VLGLIEPLVV DTRNRLLAGG HRLSAIHFLR DNKQERYDEQ FPGSKIPVRV       120
     MPFDADQDPE KALQCEVAEN EHRRDYTATE VRNLAERLKK AGYSHGKGRP RKGKKALLPA       180
     LEVIIGKHTR TIQRYLSDHQ KENTTNVALT AETKKLKRIE KDLLAWKNEN MHCTANSKKA       240
     LLLKRIPSMA KLINQVLTEI QTQDGN                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page