(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE39

ACAM1_7.PE39         Location/Qualifiers
FT   CDS             31038..31532
FT                   /locus_tag="AM1_F0039"
FT                   /gene_family="HOG000023291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341291"
FT                   /db_xref="GeneID:5686960"
FT                   /translation="MARKSKGFSELLHQQQDDEQTTAQSFNRLQKKVKKTTGKDLIKDI
FT                   ATSPKGITKMSDVLEEFIDPYKETTSSFEDVESLLSIAVLAWNIALLPDEDRQEAIEII
FT                   LSEAASGMNQKSRAELQTLIHQMIERKDCYFSSFQRYIANFDLQPQGDSYFLSVASSLK
FT                   E"
FT                   /protein_id="YP_001522345.1"
     MARKSKGFSE LLHQQQDDEQ TTAQSFNRLQ KKVKKTTGKD LIKDIATSPK GITKMSDVLE        60
     EFIDPYKETT SSFEDVESLL SIAVLAWNIA LLPDEDRQEA IEIILSEAAS GMNQKSRAEL       120
     QTLIHQMIER KDCYFSSFQR YIANFDLQPQ GDSYFLSVAS SLKE                        164
//

If you have problems or comments...

PBIL Back to PBIL home page