(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE7

ACAM1_7.PE7          Location/Qualifiers
FT   CDS             10123..10650
FT                   /locus_tag="AM1_F0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341323"
FT                   /db_xref="GeneID:5686928"
FT                   /translation="MYLFSRGYFSHYQRDFLEFANSVNPSITPFKKYHVGPQVGESDAA
FT                   VELFSDETREADDRALLLKVRDMVRGAADIAKFTQIVEQMRDATERKIEGNPVTAVEVL
FT                   GDKLNVNQEERSGILTHLIQGGDLTAYGMMNAVTRTSQDVESYDRATELEAMGSQVLSL
FT                   PKATWREIAVAR"
FT                   /protein_id="YP_001522313.1"
     MYLFSRGYFS HYQRDFLEFA NSVNPSITPF KKYHVGPQVG ESDAAVELFS DETREADDRA        60
     LLLKVRDMVR GAADIAKFTQ IVEQMRDATE RKIEGNPVTA VEVLGDKLNV NQEERSGILT       120
     HLIQGGDLTA YGMMNAVTRT SQDVESYDRA TELEAMGSQV LSLPKATWRE IAVAR            175
//

If you have problems or comments...

PBIL Back to PBIL home page