(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE8

ACAM1_7.PE8          Location/Qualifiers
FT   CDS             complement(10713..10979)
FT                   /locus_tag="AM1_F0008"
FT                   /gene_family="HOG000219995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid stability protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341322"
FT                   /db_xref="GeneID:5686929"
FT                   /translation="MSYSVFLAPAAERQLKKLPNKVKAQIVPILKTLTDDPHPSGSAKL
FT                   KGAEDLWKIRKGAYRVIYQIQDKKLTILVVNIAHRRDVYKDKS"
FT                   /protein_id="YP_001522314.1"
     MSYSVFLAPA AERQLKKLPN KVKAQIVPIL KTLTDDPHPS GSAKLKGAED LWKIRKGAYR        60
     VIYQIQDKKL TILVVNIAHR RDVYKDKS                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page