(data stored in ACNUC30567 zone)

HOGENOMDNA: ACAM1_7.PE9

ACAM1_7.PE9          Location/Qualifiers
FT   CDS             complement(10987..11370)
FT                   /locus_tag="AM1_F0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:158341321"
FT                   /db_xref="GeneID:5686930"
FT                   /translation="MLLIWNTLSSKIVGTKRKINPKSLQNLRPGKSPGRTTLHESTKSR
FT                   HGVSLTDEGWSGVQEAAKKYGYSVSEFLEQIGRGNLAILELEAIEAFQDALDLAEAQTA
FT                   IAEARLVGVRPLEDVLSEIGLED"
FT                   /protein_id="YP_001522315.1"
     MLLIWNTLSS KIVGTKRKIN PKSLQNLRPG KSPGRTTLHE STKSRHGVSL TDEGWSGVQE        60
     AAKKYGYSVS EFLEQIGRGN LAILELEAIE AFQDALDLAE AQTAIAEARL VGVRPLEDVL       120
     SEIGLED                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page