(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE1

ACCPU_3.PE1          Location/Qualifiers
FT   CDS             1001..1258
FT                   /locus_tag="CAP2UW1_4568"
FT                   /gene_family="HOG000133818" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091506"
FT                   /db_xref="GeneID:8402109"
FT                   /translation="MIYACTNDTDLDELIGTQCWEGQRLSFHYGPLVQAMKAGEELVLE
FT                   NSAALSAFMLAKVRLMLGAMTIEDTSEEIYPHDGFRLTLG"
FT                   /protein_id="YP_003165149.1"
     MIYACTNDTD LDELIGTQCW EGQRLSFHYG PLVQAMKAGE ELVLENSAAL SAFMLAKVRL        60
     MLGAMTIEDT SEEIYPHDGF RLTLG                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page