(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE10

ACCPU_3.PE10         Location/Qualifiers
FT   CDS             complement(9495..9851)
FT                   /locus_tag="CAP2UW1_4577"
FT                   /gene_family="HOG000000205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091515"
FT                   /db_xref="GeneID:8401950"
FT                   /translation="MLIPPDYAAWLAELKTTIRTARLKAGLAVNRELVLLYWRIGKEIL
FT                   ERQSAQGWGAKVIDQLARDLRVEFPDMRGLSPRNMKYMRAFAEAWPEEGFVQQAAAQIT
FT                   WFHNCILLDQVKDG"
FT                   /protein_id="YP_003165158.1"
     MLIPPDYAAW LAELKTTIRT ARLKAGLAVN RELVLLYWRI GKEILERQSA QGWGAKVIDQ        60
     LARDLRVEFP DMRGLSPRNM KYMRAFAEAW PEEGFVQQAA AQITWFHNCI LLDQVKDG         118
//

If you have problems or comments...

PBIL Back to PBIL home page