(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE100

ACCPU_3.PE100        Location/Qualifiers
FT   CDS             complement(110700..111698)
FT                   /locus_tag="CAP2UW1_4676"
FT                   /gene_family="HOG000260057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091605"
FT                   /db_xref="GeneID:8402040"
FT                   /translation="MTHFRKSIATVLLSLVAGAALADATLLNASYDVARDVYKDYNPMF
FT                   QKHWKANAGESVELKQSHGGSTKQVRAVADGLEADVVTMNQANDIEFLAEKGLVAKDWA
FT                   KKFPNNASPYTSAMVFIVRKGNPKALKDWADLAAPGVQVIMPHPKNTGNGRNTYLSAWA
FT                   WALKQPGGSDKTAQEFVGKLLKNAPLFAAGGRDATTTFMQRGMGDALITFESEAEMIAK
FT                   EFGKGNFEVVYPSLTMQTEFPVAVVEKVVDKKGTRKQATAYLEYLWSKEGQENAAQNYL
FT                   RPRDAELLKKYAAFFPPVKTFTVDEVFGGANKAFATHFKDGGTFDQIYVAK"
FT                   /protein_id="YP_003165248.1"
     MTHFRKSIAT VLLSLVAGAA LADATLLNAS YDVARDVYKD YNPMFQKHWK ANAGESVELK        60
     QSHGGSTKQV RAVADGLEAD VVTMNQANDI EFLAEKGLVA KDWAKKFPNN ASPYTSAMVF       120
     IVRKGNPKAL KDWADLAAPG VQVIMPHPKN TGNGRNTYLS AWAWALKQPG GSDKTAQEFV       180
     GKLLKNAPLF AAGGRDATTT FMQRGMGDAL ITFESEAEMI AKEFGKGNFE VVYPSLTMQT       240
     EFPVAVVEKV VDKKGTRKQA TAYLEYLWSK EGQENAAQNY LRPRDAELLK KYAAFFPPVK       300
     TFTVDEVFGG ANKAFATHFK DGGTFDQIYV AK                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page