(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE101

ACCPU_3.PE101        Location/Qualifiers
FT   CDS             complement(111969..112397)
FT                   /locus_tag="CAP2UW1_4677"
FT                   /gene_family="HOG000133766" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091606"
FT                   /db_xref="GeneID:8402041"
FT                   /translation="MSAVAKILPTCILGVTLSGCAGHTHQLESVNESSPVTGSFSHDGT
FT                   QVPVMVLELEGARYEGRGFEIRRHQDLAEMRKLYGPGKHYDRIASGVDRDHLRSSASPV
FT                   LRAPNGETIRCLLTWGPGQDPAGVCTKSDGKQIAVRFD"
FT                   /protein_id="YP_003165249.1"
     MSAVAKILPT CILGVTLSGC AGHTHQLESV NESSPVTGSF SHDGTQVPVM VLELEGARYE        60
     GRGFEIRRHQ DLAEMRKLYG PGKHYDRIAS GVDRDHLRSS ASPVLRAPNG ETIRCLLTWG       120
     PGQDPAGVCT KSDGKQIAVR FD                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page