(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE102

ACCPU_3.PE102        Location/Qualifiers
FT   CDS             complement(112410..112793)
FT                   /locus_tag="CAP2UW1_4678"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091607"
FT                   /db_xref="GeneID:8402042"
FT                   /translation="MKPIYFLAAFAFSMSGLAFAAGGHDHGHERKPLHGGVVSEVKDVD
FT                   YELVVKPDLIQLHLRDHGKPVDVSKSNAKLTILVGADKQEVELKPVGQQLEATGSFKFA
FT                   NSKIVALVSVPGKATATVRFVLK"
FT                   /protein_id="YP_003165250.1"
     MKPIYFLAAF AFSMSGLAFA AGGHDHGHER KPLHGGVVSE VKDVDYELVV KPDLIQLHLR        60
     DHGKPVDVSK SNAKLTILVG ADKQEVELKP VGQQLEATGS FKFANSKIVA LVSVPGKATA       120
     TVRFVLK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page