(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE103

ACCPU_3.PE103        Location/Qualifiers
FT   CDS             complement(112819..115938)
FT                   /locus_tag="CAP2UW1_4679"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091608"
FT                   /db_xref="GeneID:8402043"
FT                   /translation="MFKWLLDNSLANRLLVIIASLVLMAYGAFTLSRTPVDVFPDLNKP
FT                   TVTIMTESGGMAAEEVEQLITFPLETTMNGLPGVESVRSVSSAGLSFIYVTFNWRTEIF
FT                   RARQMVSERLSSMEEGLPTGVTPRMGPISSIMGEIMQIAIPIDTAKISPMQVREYADWV
FT                   LRPRLMAIAGVAQVIPIGGEVRQFQVQPNTTRMAELGISHEQLTGALKGYSANTSGGFL
FT                   ELNGREYLIRHLGRTSRLDDLKNLALTARHGQPVLLRQIADVTFAPAIKRGDAGFEGKP
FT                   AVILGIQKQPTADTIHLTRSIEAAVEDLKKSLPAGMEAPKVTFRQASFIESSISTLQGK
FT                   LIGASVFVAVILFFFLGTLRPTVIALTAIPVSIFITALVFDYYGLSINTMTLGGLAIAI
FT                   GGLVDDAVVGVENVLRRLKEDRAKHHDHRMHPIELVAHATMEVRSAILYATIIIVLVFL
FT                   PLFALPGMEGRLFVPLGIAFIVSTLASLVVSVTVTPVLSFYLLPRMKSLDHGDTKLLAW
FT                   LKASYGRSLQAVLNRPKAALAAGAVAVLVAAVAVPFFPKTFLPPFNEGTLLIGMRLNPG
FT                   VTLAESSALAQQAEVLVKAVPEVVHVGRRSGRAELDEHAEGVHVSELDVGLKPASEMTR
FT                   SMGEISADIRARLINLPAAVAIGQPISHRIDHMLSGVRSQIAIKIFGDDLDTLRGQADV
FT                   LRGRLAGIPGVVDLEIEKQVLAPQIKVSVNYATAAQYGVPTPQILATLQSLVEGEKVTQ
FT                   VVEGGRRFALVVRLPESSRSLQGLGRILLETPGGPIPLSKIATIEDGDGPNQVSRDDGK
FT                   RRIVISANAQGRALSEIIEDIRKVVGDSKLPEGYFITLGGQFQAQEEASRLVGLLSIVS
FT                   LVLMFVVLFSRYKSVVLSALIMANIPLALVGAVLGLWLSGQPLSVAALVGFITLAGISV
FT                   RNGILKVSHYINLMRIEGENFDHKMILRGSLERLAPVLMTALVTAFALAPLLFEAERPG
FT                   TEILHPVAVVIFSGLISSTLLDTFLTPAMFWLFGRKDAERLMNDSDAGAL"
FT                   /protein_id="YP_003165251.1"
     MFKWLLDNSL ANRLLVIIAS LVLMAYGAFT LSRTPVDVFP DLNKPTVTIM TESGGMAAEE        60
     VEQLITFPLE TTMNGLPGVE SVRSVSSAGL SFIYVTFNWR TEIFRARQMV SERLSSMEEG       120
     LPTGVTPRMG PISSIMGEIM QIAIPIDTAK ISPMQVREYA DWVLRPRLMA IAGVAQVIPI       180
     GGEVRQFQVQ PNTTRMAELG ISHEQLTGAL KGYSANTSGG FLELNGREYL IRHLGRTSRL       240
     DDLKNLALTA RHGQPVLLRQ IADVTFAPAI KRGDAGFEGK PAVILGIQKQ PTADTIHLTR       300
     SIEAAVEDLK KSLPAGMEAP KVTFRQASFI ESSISTLQGK LIGASVFVAV ILFFFLGTLR       360
     PTVIALTAIP VSIFITALVF DYYGLSINTM TLGGLAIAIG GLVDDAVVGV ENVLRRLKED       420
     RAKHHDHRMH PIELVAHATM EVRSAILYAT IIIVLVFLPL FALPGMEGRL FVPLGIAFIV       480
     STLASLVVSV TVTPVLSFYL LPRMKSLDHG DTKLLAWLKA SYGRSLQAVL NRPKAALAAG       540
     AVAVLVAAVA VPFFPKTFLP PFNEGTLLIG MRLNPGVTLA ESSALAQQAE VLVKAVPEVV       600
     HVGRRSGRAE LDEHAEGVHV SELDVGLKPA SEMTRSMGEI SADIRARLIN LPAAVAIGQP       660
     ISHRIDHMLS GVRSQIAIKI FGDDLDTLRG QADVLRGRLA GIPGVVDLEI EKQVLAPQIK       720
     VSVNYATAAQ YGVPTPQILA TLQSLVEGEK VTQVVEGGRR FALVVRLPES SRSLQGLGRI       780
     LLETPGGPIP LSKIATIEDG DGPNQVSRDD GKRRIVISAN AQGRALSEII EDIRKVVGDS       840
     KLPEGYFITL GGQFQAQEEA SRLVGLLSIV SLVLMFVVLF SRYKSVVLSA LIMANIPLAL       900
     VGAVLGLWLS GQPLSVAALV GFITLAGISV RNGILKVSHY INLMRIEGEN FDHKMILRGS       960
     LERLAPVLMT ALVTAFALAP LLFEAERPGT EILHPVAVVI FSGLISSTLL DTFLTPAMFW      1020
     LFGRKDAERL MNDSDAGAL                                                   1039
//

If you have problems or comments...

PBIL Back to PBIL home page