(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE104

ACCPU_3.PE104        Location/Qualifiers
FT   CDS             complement(115951..116973)
FT                   /locus_tag="CAP2UW1_4680"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091609"
FT                   /db_xref="GeneID:8402044"
FT                   /translation="MRPRLLLSAFCLSFLLSPMPALAGDGHDHGDAPPAASGSGPKRQP
FT                   DGSVFLPKPAQRQIGVRTLLVEPGELPRTHELAGKVVMDPNAGGKVQAIVAGRVTPGPR
FT                   GLPLPGQQVKKGEVLAYVTPEVGGNSRSLAESRLRRLRELSDTVPRKVIEEAEAAVANE
FT                   QLVAPVSGVIASANVVSGQVLEAREILFEIVNPERLLIEALAFDMAVASDVAGAFVAVG
FT                   EQKLPLRLVGVARSLREQALPLTFRGEGSALAGLAVGQPVRVFVQTRSTVPGIRVPAAA
FT                   LMKNPANQSIVWVKTAPERFEPRTVTAEPLDGTHVAVTSGLKAGDRVAVRAATLINQIR
FT                   "
FT                   /protein_id="YP_003165252.1"
     MRPRLLLSAF CLSFLLSPMP ALAGDGHDHG DAPPAASGSG PKRQPDGSVF LPKPAQRQIG        60
     VRTLLVEPGE LPRTHELAGK VVMDPNAGGK VQAIVAGRVT PGPRGLPLPG QQVKKGEVLA       120
     YVTPEVGGNS RSLAESRLRR LRELSDTVPR KVIEEAEAAV ANEQLVAPVS GVIASANVVS       180
     GQVLEAREIL FEIVNPERLL IEALAFDMAV ASDVAGAFVA VGEQKLPLRL VGVARSLREQ       240
     ALPLTFRGEG SALAGLAVGQ PVRVFVQTRS TVPGIRVPAA ALMKNPANQS IVWVKTAPER       300
     FEPRTVTAEP LDGTHVAVTS GLKAGDRVAV RAATLINQIR                             340
//

If you have problems or comments...

PBIL Back to PBIL home page