(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE105

ACCPU_3.PE105        Location/Qualifiers
FT   CDS             complement(116970..117524)
FT                   /locus_tag="CAP2UW1_4681"
FT                   /gene_family="HOG000219674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091610"
FT                   /db_xref="GeneID:8402045"
FT                   /translation="MRTTNTLVALGWAAWIVLATPLAWAGGDHGEAPASSAGPTSPLFA
FT                   ATSETFELVGVVNGKQLTLYLDRYADGSPVKNARLELELGGVKVPVEAHAEGEFEATLA
FT                   QELKPGVVSVVATVIAGEETDLLAGELDIHEEAHGETSAHTHGWKEYALWGGAAGGALL
FT                   LLAALLRRLRASRNPHFGGAA"
FT                   /protein_id="YP_003165253.1"
     MRTTNTLVAL GWAAWIVLAT PLAWAGGDHG EAPASSAGPT SPLFAATSET FELVGVVNGK        60
     QLTLYLDRYA DGSPVKNARL ELELGGVKVP VEAHAEGEFE ATLAQELKPG VVSVVATVIA       120
     GEETDLLAGE LDIHEEAHGE TSAHTHGWKE YALWGGAAGG ALLLLAALLR RLRASRNPHF       180
     GGAA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page