(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE106

ACCPU_3.PE106        Location/Qualifiers
FT   CDS             complement(117536..118834)
FT                   /locus_tag="CAP2UW1_4682"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091611"
FT                   /db_xref="GeneID:8402046"
FT                   /translation="MSRSKSISRTTFLPARLVVAGLCSLAAIATGDLWAQSTSAPAGAV
FT                   ITLSQAFAAAWERQPEAQSLDLRRDAAEARRQVAGSWTAQAPSLDLYGKTDQLSKNQGS
FT                   REYAAGVVLPLWLPGERSRQGALADAESKAVDSRVTAAQLRTAAAVRDAWWNWQRARGE
FT                   QSLARERLVSAQKLAEDVRRRVKAGDLARSDQHQADGVAASAEVTLAESASLLAAATQQ
FT                   LRALIGKLPDVAAADGPETPPAVPADFTALDSTHPAVVELFDRAEVARRSADLASVQTR
FT                   SNPELLLATTRERGAFGDDYQQTVTLGVRIPFGSESRNRAKLGLARAEALETEGQLRLE
FT                   RERLAADLEAARVRVESSRTQLAAAEKRTQLARESRGFFDKSFRLGESDLPTRLRIELE
FT                   SVEAERQNARARIDLAAAISALRQALGLLPEQK"
FT                   /protein_id="YP_003165254.1"
     MSRSKSISRT TFLPARLVVA GLCSLAAIAT GDLWAQSTSA PAGAVITLSQ AFAAAWERQP        60
     EAQSLDLRRD AAEARRQVAG SWTAQAPSLD LYGKTDQLSK NQGSREYAAG VVLPLWLPGE       120
     RSRQGALADA ESKAVDSRVT AAQLRTAAAV RDAWWNWQRA RGEQSLARER LVSAQKLAED       180
     VRRRVKAGDL ARSDQHQADG VAASAEVTLA ESASLLAAAT QQLRALIGKL PDVAAADGPE       240
     TPPAVPADFT ALDSTHPAVV ELFDRAEVAR RSADLASVQT RSNPELLLAT TRERGAFGDD       300
     YQQTVTLGVR IPFGSESRNR AKLGLARAEA LETEGQLRLE RERLAADLEA ARVRVESSRT       360
     QLAAAEKRTQ LARESRGFFD KSFRLGESDL PTRLRIELES VEAERQNARA RIDLAAAISA       420
     LRQALGLLPE QK                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page