(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE107

ACCPU_3.PE107        Location/Qualifiers
FT   CDS             complement(118969..119325)
FT                   /locus_tag="CAP2UW1_4683"
FT                   /gene_family="HOG000229574" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091612"
FT                   /db_xref="GeneID:8402047"
FT                   /translation="MRRWLSILLLVFLPFQFSWAAVAGYCQHESGAAAQHFGHHDHQHQ
FT                   AAADQEGTPDAKALGGGIDSDCVACHASCAAAIFSMASLPASSSASIAIPWSPGNLTAP
FT                   PLAHPERPNWSVLA"
FT                   /protein_id="YP_003165255.1"
     MRRWLSILLL VFLPFQFSWA AVAGYCQHES GAAAQHFGHH DHQHQAAADQ EGTPDAKALG        60
     GGIDSDCVAC HASCAAAIFS MASLPASSSA SIAIPWSPGN LTAPPLAHPE RPNWSVLA         118
//

If you have problems or comments...

PBIL Back to PBIL home page