(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE109

ACCPU_3.PE109        Location/Qualifiers
FT   CDS             complement(119484..119921)
FT                   /locus_tag="CAP2UW1_4685"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091614"
FT                   /db_xref="GeneID:8402049"
FT                   /translation="MLKKLIACLLVTTALQGALAAQLPEVTVYKNPDCDCCTEWVKHMQ
FT                   ESGFQVKQVNTRAMDVERQRFGVPPHLASCHTAKVGGYTVEGHVPASAVKKMLTEQPSV
FT                   RGLTIPGMPTNAPGMGPHIVGTLKVYTLPKEGESSRLYSVE"
FT                   /protein_id="YP_003165257.1"
     MLKKLIACLL VTTALQGALA AQLPEVTVYK NPDCDCCTEW VKHMQESGFQ VKQVNTRAMD        60
     VERQRFGVPP HLASCHTAKV GGYTVEGHVP ASAVKKMLTE QPSVRGLTIP GMPTNAPGMG       120
     PHIVGTLKVY TLPKEGESSR LYSVE                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page