(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE111

ACCPU_3.PE111        Location/Qualifiers
FT   CDS             complement(120504..121106)
FT                   /locus_tag="CAP2UW1_4687"
FT                   /gene_family="HOG000096993" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091616"
FT                   /db_xref="GeneID:8402051"
FT                   /translation="MDRTRLIVTMTALAALPRAETAQQGSGDRASAPQIIPRKPMMDRY
FT                   RWLGLAIGVALADQWAKHWIAGTFPLGAGETVLPFFNLVHILNSGAAFSFLANAGGWQR
FT                   YVLIALALAVSVGLTIMLLKGVANRWEGWGYSLLLGGAVGNLVDRLGRGAVVDYLDFHA
FT                   GGWHWPAFNLADTALCLSALILLLGTLPSSAQSKAPT"
FT                   /protein_id="YP_003165259.1"
     MDRTRLIVTM TALAALPRAE TAQQGSGDRA SAPQIIPRKP MMDRYRWLGL AIGVALADQW        60
     AKHWIAGTFP LGAGETVLPF FNLVHILNSG AAFSFLANAG GWQRYVLIAL ALAVSVGLTI       120
     MLLKGVANRW EGWGYSLLLG GAVGNLVDRL GRGAVVDYLD FHAGGWHWPA FNLADTALCL       180
     SALILLLGTL PSSAQSKAPT                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page