(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE112

ACCPU_3.PE112        Location/Qualifiers
FT   CDS             complement(121228..121566)
FT                   /locus_tag="CAP2UW1_4688"
FT                   /gene_family="HOG000262961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091617"
FT                   /db_xref="GeneID:8402052"
FT                   /translation="MRYAWISGLTALLAAGAVLAAEVRPPGKAQQVCAACHGTDGNSAT
FT                   DQFPRIAGQREAYLVGALRAYRDGRRIDPVMKPQVEGLSDEDMGKLAAYYAAQAGLTVK
FT                   QPTWGNCW"
FT                   /protein_id="YP_003165260.1"
     MRYAWISGLT ALLAAGAVLA AEVRPPGKAQ QVCAACHGTD GNSATDQFPR IAGQREAYLV        60
     GALRAYRDGR RIDPVMKPQV EGLSDEDMGK LAAYYAAQAG LTVKQPTWGN CW               112
//

If you have problems or comments...

PBIL Back to PBIL home page