(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE113

ACCPU_3.PE113        Location/Qualifiers
FT   CDS             complement(121563..121907)
FT                   /locus_tag="CAP2UW1_4689"
FT                   /gene_family="HOG000262961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091618"
FT                   /db_xref="GeneID:8402053"
FT                   /translation="MKYLAMMALFLMTGTSAHAQNWGMGRADGGWNKVEMCHGCHDMAM
FT                   RGGMGMGIRMGPGETAPKLGGQHAAYLEKSLRAYRSGERRHPLMNRMASMLDDREIAEI
FT                   AAFYARKDNK"
FT                   /protein_id="YP_003165261.1"
     MKYLAMMALF LMTGTSAHAQ NWGMGRADGG WNKVEMCHGC HDMAMRGGMG MGIRMGPGET        60
     APKLGGQHAA YLEKSLRAYR SGERRHPLMN RMASMLDDRE IAEIAAFYAR KDNK             114
//

If you have problems or comments...

PBIL Back to PBIL home page