(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE114

ACCPU_3.PE114        Location/Qualifiers
FT   CDS             complement(121904..124150)
FT                   /locus_tag="CAP2UW1_4690"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091619"
FT                   /db_xref="GeneID:8402054"
FT                   /translation="MSLDPNPKPLPETAHCGCAGGCSAAVTTAAEIPAASGLVQSDGVP
FT                   VFLIPTMDCPNEENDIRRAVAGIDGIRSLRFQLSARTVSIDATTESLDAALAAIRKAGF
FT                   SPKAVSAEQAATKNAGVSELWRSVLALVLAIGAEAVDYFAPDTLPFKGFGMALAVVAIW
FT                   LSGISTYSKGLAALRRGQLNMNALMGVAVTGAFLIGQWPEAAMVMALYAIAELIEARSV
FT                   DRARNAIKGLLDLTPETAEVRQDDGTWLEVPAAEVKLEASVRVKPGARIPLDGQVTAGS
FT                   SAVNQAPVTGESIPIDKAAGDPVFAGTINETGILEFRVTAAADNTTLARIIHAVEQAQG
FT                   TQAPTQRFVDRFAAIYTPTVFAIAVAVAVLTPLLLGWSWTQALYKALVLLVIACPCALV
FT                   IATPVTVVSGLAAAARRGILIKGGVYLEEARKLRVIALDKTGTITEGKPRLVAMEILPS
FT                   AVPESQVLAWAASLAGHSDHPVSKAIATGLKLPENGLTDFVALAGRGVEARTDGQLIVL
FT                   GNHRLVEERNLCSAEIEARLQLHETQGRTVTMLASAQQVLAIFAVADTIKESSREAVAD
FT                   LHRLGVASAMLTGDNVATAASIAREAGIDDVRGNLLPEDKLAAIEDLQRRYGQTAMTGD
FT                   GINDAPALARADIGVAMGAAGTDTAMEAADVVIMNDDLRRIPETIRLSRRTHAVLWQNI
FT                   GLALGIKAIFLGLAVFGNATMWMAVFADMGASLLVVANGLRLLRVTGPGKETAA"
FT                   /protein_id="YP_003165262.1"
     MSLDPNPKPL PETAHCGCAG GCSAAVTTAA EIPAASGLVQ SDGVPVFLIP TMDCPNEEND        60
     IRRAVAGIDG IRSLRFQLSA RTVSIDATTE SLDAALAAIR KAGFSPKAVS AEQAATKNAG       120
     VSELWRSVLA LVLAIGAEAV DYFAPDTLPF KGFGMALAVV AIWLSGISTY SKGLAALRRG       180
     QLNMNALMGV AVTGAFLIGQ WPEAAMVMAL YAIAELIEAR SVDRARNAIK GLLDLTPETA       240
     EVRQDDGTWL EVPAAEVKLE ASVRVKPGAR IPLDGQVTAG SSAVNQAPVT GESIPIDKAA       300
     GDPVFAGTIN ETGILEFRVT AAADNTTLAR IIHAVEQAQG TQAPTQRFVD RFAAIYTPTV       360
     FAIAVAVAVL TPLLLGWSWT QALYKALVLL VIACPCALVI ATPVTVVSGL AAAARRGILI       420
     KGGVYLEEAR KLRVIALDKT GTITEGKPRL VAMEILPSAV PESQVLAWAA SLAGHSDHPV       480
     SKAIATGLKL PENGLTDFVA LAGRGVEART DGQLIVLGNH RLVEERNLCS AEIEARLQLH       540
     ETQGRTVTML ASAQQVLAIF AVADTIKESS REAVADLHRL GVASAMLTGD NVATAASIAR       600
     EAGIDDVRGN LLPEDKLAAI EDLQRRYGQT AMTGDGINDA PALARADIGV AMGAAGTDTA       660
     MEAADVVIMN DDLRRIPETI RLSRRTHAVL WQNIGLALGI KAIFLGLAVF GNATMWMAVF       720
     ADMGASLLVV ANGLRLLRVT GPGKETAA                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page