(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE115

ACCPU_3.PE115        Location/Qualifiers
FT   CDS             124240..124578
FT                   /locus_tag="CAP2UW1_4691"
FT                   /gene_family="HOG000223633" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091620"
FT                   /db_xref="GeneID:8402055"
FT                   /translation="MLEFVKVLGLFAITALAEIVGCYLPWLVLTQQRPVWLLIPAAVSL
FT                   GLFAWLLTLHPGAAGRIYAAYGGVYVAIALIWLWRIDGVVPTSWDYVGSAVSLAGMAII
FT                   MLQPARSV"
FT                   /protein_id="YP_003165263.1"
     MLEFVKVLGL FAITALAEIV GCYLPWLVLT QQRPVWLLIP AAVSLGLFAW LLTLHPGAAG        60
     RIYAAYGGVY VAIALIWLWR IDGVVPTSWD YVGSAVSLAG MAIIMLQPAR SV               112
//

If you have problems or comments...

PBIL Back to PBIL home page