(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE116

ACCPU_3.PE116        Location/Qualifiers
FT   CDS             124595..125071
FT                   /locus_tag="CAP2UW1_4692"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091621"
FT                   /db_xref="GeneID:8402056"
FT                   /translation="MKIGELARLAGTNVETIRYYERDGLLPVPARSEGNYRIYGDAHVQ
FT                   RLSFIRRCRSLDMTLDEIRVLLHFKESPQENCADVNRLLDRHIGHVAQRMQELQELESQ
FT                   LKDLRERCDEGRDAAHCGILDGLSQAIVHSEKTVSHVQGTHRSSLAKGNQGNQV"
FT                   /protein_id="YP_003165264.1"
     MKIGELARLA GTNVETIRYY ERDGLLPVPA RSEGNYRIYG DAHVQRLSFI RRCRSLDMTL        60
     DEIRVLLHFK ESPQENCADV NRLLDRHIGH VAQRMQELQE LESQLKDLRE RCDEGRDAAH       120
     CGILDGLSQA IVHSEKTVSH VQGTHRSSLA KGNQGNQV                               158
//

If you have problems or comments...

PBIL Back to PBIL home page