(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE117

ACCPU_3.PE117        Location/Qualifiers
FT   CDS             complement(125367..126380)
FT                   /locus_tag="CAP2UW1_4693"
FT                   /gene_family="HOG000045296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091622"
FT                   /db_xref="GeneID:8402057"
FT                   /translation="MRRQPKPAPSFPALVQAFFVEHLTQQRALSPQTVAAYRDAFVLFL
FT                   GFAEVRLGRSPALITLADITPDLITAFLDHLERKRHNSVRSRNGRLAALRSFLKFAAHR
FT                   DVTSLQVIEHALGVPAKRFERPMLGYLSREEMLAVIGTPDGTWFSQRDHVLVLLLYNTG
FT                   ARVSEIVGVKVGEVVLDDGAACVHLHGKGRKQRSVPLWRSTIRAIRAWIKRNPQFDSDS
FT                   PLLHNRDGQAMSRWNVMQRLDRAVQVATESCPELATRHISPHVIRHTTAMHLLQAGVDI
FT                   SVIALWLGHESPATTHQYVEADLAMKERALARLQEPETKLRRYRAPDSLIDFLRTL"
FT                   /protein_id="YP_003165265.1"
     MRRQPKPAPS FPALVQAFFV EHLTQQRALS PQTVAAYRDA FVLFLGFAEV RLGRSPALIT        60
     LADITPDLIT AFLDHLERKR HNSVRSRNGR LAALRSFLKF AAHRDVTSLQ VIEHALGVPA       120
     KRFERPMLGY LSREEMLAVI GTPDGTWFSQ RDHVLVLLLY NTGARVSEIV GVKVGEVVLD       180
     DGAACVHLHG KGRKQRSVPL WRSTIRAIRA WIKRNPQFDS DSPLLHNRDG QAMSRWNVMQ       240
     RLDRAVQVAT ESCPELATRH ISPHVIRHTT AMHLLQAGVD ISVIALWLGH ESPATTHQYV       300
     EADLAMKERA LARLQEPETK LRRYRAPDSL IDFLRTL                                337
//

If you have problems or comments...

PBIL Back to PBIL home page