(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE118

ACCPU_3.PE118        Location/Qualifiers
FT   CDS             complement(126373..127347)
FT                   /locus_tag="CAP2UW1_4694"
FT                   /gene_family="HOG000223692" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091623"
FT                   /db_xref="GeneID:8402058"
FT                   /translation="MSRRRSLQARIDDYLAERRRQGFHLRSRDTFLSGFARFVETKGHH
FT                   GPLTAELMVEWVRAGKDGHGDVGTWARSWGRLRHFICYLRQFEPDTEIPEASLFGPEPG
FT                   RVAPHIYREDEVVDLLAAARTLGPSGSLRPFTYETLFGLMASTGLRVSEAIHLRDTDVD
FT                   LKRGMLTIRQTKFAKSRQLPIHPSTVKALVRYRKQRERHLPMTTGMPFLIGSRGCRLGL
FT                   PLGERQAHRVFTSLRDGLGWVNRGGHDAPRLHDLRHTFAVRRLVRWYADGADVDQKMLA
FT                   LSTYMGHAEIFYTYWYLTAVPELMAIAASRFEQFADLAGDDDA"
FT                   /protein_id="YP_003165266.1"
     MSRRRSLQAR IDDYLAERRR QGFHLRSRDT FLSGFARFVE TKGHHGPLTA ELMVEWVRAG        60
     KDGHGDVGTW ARSWGRLRHF ICYLRQFEPD TEIPEASLFG PEPGRVAPHI YREDEVVDLL       120
     AAARTLGPSG SLRPFTYETL FGLMASTGLR VSEAIHLRDT DVDLKRGMLT IRQTKFAKSR       180
     QLPIHPSTVK ALVRYRKQRE RHLPMTTGMP FLIGSRGCRL GLPLGERQAH RVFTSLRDGL       240
     GWVNRGGHDA PRLHDLRHTF AVRRLVRWYA DGADVDQKML ALSTYMGHAE IFYTYWYLTA       300
     VPELMAIAAS RFEQFADLAG DDDA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page