(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE119

ACCPU_3.PE119        Location/Qualifiers
FT   CDS             complement(127344..128300)
FT                   /locus_tag="CAP2UW1_4695"
FT                   /gene_family="HOG000224853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091624"
FT                   /db_xref="GeneID:8402059"
FT                   /translation="MNRISPPRSAQQVRSSAEIPDPIADELHRYDDHLRDVRGLAAGTR
FT                   RNHCRIVAQLLRKKFAGGVVTIAKLSAADVRRFIARQLGDSPSHSAAAQVATALRSYLR
FT                   YRTVCGDSVVRLSAAISSPVQWKLASLPRALKPDEVQRLLAALPYGRKPRRGYAIVRCA
FT                   LDMGLRAGEIANLSIDAIDWREGTVTLKGTKSRRQDILPLPMATGQALADYLQHERLAN
FT                   PSRALFLCRRESRDIPITTYAVENVIRRACRRAGLPDSGSHLLRHTLACRLVGNGSSLK
FT                   EVADVLRHRSLETTRIYAKLDTPKLTEVPLPWPGSES"
FT                   /protein_id="YP_003165267.1"
     MNRISPPRSA QQVRSSAEIP DPIADELHRY DDHLRDVRGL AAGTRRNHCR IVAQLLRKKF        60
     AGGVVTIAKL SAADVRRFIA RQLGDSPSHS AAAQVATALR SYLRYRTVCG DSVVRLSAAI       120
     SSPVQWKLAS LPRALKPDEV QRLLAALPYG RKPRRGYAIV RCALDMGLRA GEIANLSIDA       180
     IDWREGTVTL KGTKSRRQDI LPLPMATGQA LADYLQHERL ANPSRALFLC RRESRDIPIT       240
     TYAVENVIRR ACRRAGLPDS GSHLLRHTLA CRLVGNGSSL KEVADVLRHR SLETTRIYAK       300
     LDTPKLTEVP LPWPGSES                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page