(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE12

ACCPU_3.PE12         Location/Qualifiers
FT   CDS             complement(11521..11802)
FT                   /locus_tag="CAP2UW1_4580"
FT                   /gene_family="HOG000258408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091517"
FT                   /db_xref="GeneID:8402097"
FT                   /translation="MSNQRFASVWDAIEDTPEEAENMKLRSVLMTALKNHLTRTEMSQA
FT                   QAAKLLGVTQPRVSDLMRGKINLFGLDALVNMATAAGLHIEMRVLEAA"
FT                   /protein_id="YP_003165160.1"
     MSNQRFASVW DAIEDTPEEA ENMKLRSVLM TALKNHLTRT EMSQAQAAKL LGVTQPRVSD        60
     LMRGKINLFG LDALVNMATA AGLHIEMRVL EAA                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page