(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE120

ACCPU_3.PE120        Location/Qualifiers
FT   CDS             complement(128596..130911)
FT                   /locus_tag="CAP2UW1_4696"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091625"
FT                   /db_xref="GeneID:8402060"
FT                   /translation="MSHDHAIHGHTHHATSARDPVCGMDVSLDAGKPTAEHAGTVFHFC
FT                   SQKCHDKFVADPQRYLSPAPTKAEAESAGTEYVCPMHPEVRQFGPGTCPKCGMALEPAV
FT                   PELEREEDDGEFRDFRRRFWGSLPLTVAVVLLAMAGHLVAGLTPAARTWAELLLSTPVV
FT                   LWAGGPFFVRGWQSIVRRSPNMWTLIGIGTGAAFVYSVVAALAPGLFPDSFEAHGRIGV
FT                   YFEAAAVIISLTLLGQMLELRARSKTSAAIKSLLGLAPKTARRIRPDGSEEDVPLTHVH
FT                   VGDILRVRPGEKVPVDGEVTEGASAVDESMLTGEPLPVTKWPGDKVIGATLNTSGSLVI
FT                   RSEKVGAQTVLAQIVQMVAQAQRSKAPMQRLADVVAGYFVVAVVGIALLSFFGWGIFGG
FT                   ERGWLFGLINAVSVLIIACPCALGLATPMSIMVATGKAATQGILFRDAAAIERLREIDT
FT                   LIVDKTGTLTEGRPAFERAVAAPGLAEDEVLRLAASLDQGSEHPLADAIVRAAREKGLT
FT                   LDKAEGFESSSGIGVRGSVGGRRLALGNTVLMEQEGADVSPLAAQAEELRREGASVMHL
FT                   AADGQLLGLLAVADPVKASTPEALAVLRQAGLRVIMATGDGETTARAVGQRLGIDEVHG
FT                   EVKPADKLALVERLQKEGHIVAMAGDGINDAPALARADVGIAMGTGTDVAMNSAQVTLV
FT                   KGDLRGIARARLLSAATVGNMRQNLAFAFLYNALGVPIAAGVLYPSFGLVLSPIIAAAA
FT                   MSLSSVSVVGNALRLRGS"
FT                   /protein_id="YP_003165268.1"
     MSHDHAIHGH THHATSARDP VCGMDVSLDA GKPTAEHAGT VFHFCSQKCH DKFVADPQRY        60
     LSPAPTKAEA ESAGTEYVCP MHPEVRQFGP GTCPKCGMAL EPAVPELERE EDDGEFRDFR       120
     RRFWGSLPLT VAVVLLAMAG HLVAGLTPAA RTWAELLLST PVVLWAGGPF FVRGWQSIVR       180
     RSPNMWTLIG IGTGAAFVYS VVAALAPGLF PDSFEAHGRI GVYFEAAAVI ISLTLLGQML       240
     ELRARSKTSA AIKSLLGLAP KTARRIRPDG SEEDVPLTHV HVGDILRVRP GEKVPVDGEV       300
     TEGASAVDES MLTGEPLPVT KWPGDKVIGA TLNTSGSLVI RSEKVGAQTV LAQIVQMVAQ       360
     AQRSKAPMQR LADVVAGYFV VAVVGIALLS FFGWGIFGGE RGWLFGLINA VSVLIIACPC       420
     ALGLATPMSI MVATGKAATQ GILFRDAAAI ERLREIDTLI VDKTGTLTEG RPAFERAVAA       480
     PGLAEDEVLR LAASLDQGSE HPLADAIVRA AREKGLTLDK AEGFESSSGI GVRGSVGGRR       540
     LALGNTVLME QEGADVSPLA AQAEELRREG ASVMHLAADG QLLGLLAVAD PVKASTPEAL       600
     AVLRQAGLRV IMATGDGETT ARAVGQRLGI DEVHGEVKPA DKLALVERLQ KEGHIVAMAG       660
     DGINDAPALA RADVGIAMGT GTDVAMNSAQ VTLVKGDLRG IARARLLSAA TVGNMRQNLA       720
     FAFLYNALGV PIAAGVLYPS FGLVLSPIIA AAAMSLSSVS VVGNALRLRG S                771
//

If you have problems or comments...

PBIL Back to PBIL home page