(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE121

ACCPU_3.PE121        Location/Qualifiers
FT   CDS             complement(130916..131578)
FT                   /locus_tag="CAP2UW1_4697"
FT                   /gene_family="HOG000224694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091626"
FT                   /db_xref="GeneID:8402061"
FT                   /translation="MTETAPAYGLWSLVLINSVLFIFFAFSFFKPQSARDWRTLGMFSA
FT                   FVLALFTEMYGFPLTIYLLSGWLTKQFPGVDFLAHDSGHLLEVMFGWRANPHFGPFHLL
FT                   SAALIGGGFWSLAAAWRVLYAAQASGRLATSGPYARVRHPQYVAFVLIMVGFLLQWPTL
FT                   ITLVMFPILLVVYVRLARREERDSAAAFGEAWIRYASMTPAFFPRWNDGQNPASPRS"
FT                   /protein_id="YP_003165269.1"
     MTETAPAYGL WSLVLINSVL FIFFAFSFFK PQSARDWRTL GMFSAFVLAL FTEMYGFPLT        60
     IYLLSGWLTK QFPGVDFLAH DSGHLLEVMF GWRANPHFGP FHLLSAALIG GGFWSLAAAW       120
     RVLYAAQASG RLATSGPYAR VRHPQYVAFV LIMVGFLLQW PTLITLVMFP ILLVVYVRLA       180
     RREERDSAAA FGEAWIRYAS MTPAFFPRWN DGQNPASPRS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page