(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE125

ACCPU_3.PE125        Location/Qualifiers
FT   CDS             complement(132590..133027)
FT                   /locus_tag="CAP2UW1_4701"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091630"
FT                   /db_xref="GeneID:8402065"
FT                   /translation="MKPAIRTTVLLALFAPAVWAAEALPTVKVYKTPTCGCCSNWVDHM
FT                   KASGFKVVTQDMNDVTPHKQRLGVPPAMGSCHTAEVAGYLIEGHVPAADVKRLLAEKPQ
FT                   AKGLVSPGMPQSAPGMDAPGKQPYEIFLVRQDGSTATYARH"
FT                   /protein_id="YP_003165273.1"
     MKPAIRTTVL LALFAPAVWA AEALPTVKVY KTPTCGCCSN WVDHMKASGF KVVTQDMNDV        60
     TPHKQRLGVP PAMGSCHTAE VAGYLIEGHV PAADVKRLLA EKPQAKGLVS PGMPQSAPGM       120
     DAPGKQPYEI FLVRQDGSTA TYARH                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page